- TMEM179B Antibody
- Novus Biologicals, a Bio-Techne Brand
- Pricing InfoSupplier PageView Company Product Page
- NBP1-86062
- Immunocytochemistry/ Immunofluorescence
- Human
- Unconjugated
- This antibody was developed against Recombinant Protein corresponding to amino acids:FGTR SLCNSIISLN TTISCSEAQK IPWTPPGTAL QFYSNLHNAE TSS
- PBS (pH 7.2) and 40% Glycerol
- Rabbit
- 0.1 ml
- TMEM179B
- transmembrane protein 179B
- Novus Biologicals, a Bio-Techne Brand
- IgG
- Polyclonal
- Immunogen affinity purified
- Primary Antibodies
- Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles
Sequence
FGTRSLCNSIISLNTTISCSEAQKIPWTPPGTALQFYSNLHNAETSS
Specifications/Features
Available conjugates: Unconjugated